PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C03166.1.p
Common NameEUGRSUZ_C03166
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 246aa    MW: 28360.6 Da    PI: 7.6692
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C03166.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR158.91.6e-181396390
              FAR1  3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                      Y  Y  + GF v+ksk +k+ ++geit+rtfvC++eg++ +++++  k++ +r e r+gC a ++ k e ++ +e+++ + +HnHe+ 
  Eucgr.C03166.1.p 13 YVVYTIDKGFGVKKSKIRKN-NKGEITQRTFVCNCEGYSINSSDQ--KRKYERLEVRCGCPAFIRFKVE-NDAYEIIDYVYKHNHEFI 96
                      899*************9998.8888**************999877..8999*****************9.9**************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.1E-161396IPR004330FAR1 DNA binding domain
PfamPF105511.3E-10179245IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MIFASELEAY HKYVVYTIDK GFGVKKSKIR KNNKGEITQR TFVCNCEGYS INSSDQKRKY  60
ERLEVRCGCP AFIRFKVEND AYEIIDYVYK HNHEFISEHQ RHLIKCGRMI SDTCNGILVD  120
MMKAGIGGTM TYKFLANKAG GSQNLGFILH DLQNQDGRLT NLFLRDSLFK FDYDCFGDVM  180
VFDTTNCASR YNLICAPFVG VNYHWKNTLF GCAFLLDEIA NSFIWLFEVF LKSMENKDPT  240
TIFID*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C03166.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056981.11e-120PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A059CUA50.0A0A059CUA5_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1499737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-34FAR1-related sequence 5